DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and npffr1l1

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001165167.1 Gene:npffr1l1 / 559950 ZFINID:ZDB-GENE-091118-18 Length:398 Species:Danio rerio


Alignment Length:303 Identity:98/303 - (32%)
Similarity:154/303 - (50%) Gaps:19/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFIS 165
            ||...:...:.|:.:.:..::|||.||.:|.....||:|||.||.:||:.|:|:..||||::.|.
Zfish    27 SAGMAVSYILSYLLVLLLCVVGNGLVCLVVIRNRNMRSVTNLFILNLAVSDLLVGIFCVPTTLID 91

  Fly   166 LFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWF 230
             .:::.|||....|...|..|.:||..|.:|||||::||:..|::|...|:....|.|.|..:|.
Zfish    92 -SLISGWPFSQITCTMSNLVQGMSVSASVFTLVAIAVDRFTGIVYPFHHRLRPVTALFAIVFIWL 155

  Fly   231 IALATALP----IPIVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLI 291
            :|.|...|    :.::...|:.|.........::|.|.||.......||..:|...::.|||::.
Zfish   156 LAFAIIFPSAATLTVIHLDDMYMVQNDQIYPLFVCFEDWPRADMRRVYTTVIFVHVYLAPLGLIS 220

  Fly   292 FTYARITIRVWAKRPPGEAETNRDQRMARSKRKM--VKMMLTVVIVFTCCWLPFNILQLLLN--D 352
            ..|..|..::         .:|..:...||:|:|  :||::.|.::|...|||...|.||.:  |
Zfish   221 IMYGCIAAKL---------SSNLQENRLRSRRRMKVIKMLIMVAVLFMVSWLPLWTLMLLTDYQD 276

  Fly   353 EEFAHWDPL-PYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGF 394
            .:....|.| .|::...||||..:...|||||.:.|..||.||
Zfish   277 LDRQQIDFLSSYLFPVAHWLAFFNSGVNPIIYGFFNENFRRGF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 46/120 (38%)
7tm_1 122..383 CDD:278431 88/269 (33%)
npffr1l1NP_001165167.1 7tm_4 48..319 CDD:304433 93/280 (33%)
7tm_1 48..308 CDD:278431 88/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.