DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and NPY4R

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001265723.1 Gene:NPY4R / 5540 HGNCID:9329 Length:375 Species:Homo sapiens


Alignment Length:354 Identity:97/354 - (27%)
Similarity:152/354 - (42%) Gaps:49/354 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LPADDEGSNYGYGSTTTLSGLQFETYNITVMMNFS--CDDYDLLSEDMWSSAYFKIIVYMLYIPI 115
            ||...:|.|              .:..:....|||  |.|          |....:.:...|...
Human    11 LPKSPQGEN--------------RSKPLGTPYNFSEHCQD----------SVDVMVFIVTSYSIE 51

  Fly   116 FIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCH 180
            .:..::||..:..:.........|||..||:||..|.||...|.|.:.: ..|::||.||..||.
Human    52 TVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAV-YTIMDYWIFGETLCK 115

  Fly   181 FVNYSQAVSVLVSAYTLVAISIDRYIAIMWPL--KPRITKRYATFIIAGVWFIALATALPIPIVS 243
            ...:.|.:||.||..:||.::::|:..|:.|.  ||.|::.|...::  :|.||...:||....|
Human   116 MSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVL--IWVIACVLSLPFLANS 178

  Fly   244 GLDIPMSPWHTK-----CEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWA 303
            .|:......|:|     .:|.:|.|.||.......||..|...|:.:|||.::..|||| .|...
Human   179 ILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARI-YRCLQ 242

  Fly   304 KRPPGEAETNRDQRMARSKRKMVKMMLTVVIV-FTCCWLPFNILQLLLNDEEFAHWDPLP----- 362
            ::  |.........:.....|.|.::|.|::| |...|||.::    .|..|..|.:.:|     
Human   243 RQ--GRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHV----FNSLEDWHHEAIPICHGN 301

  Fly   363 YVWFAFHWLAMSHCCYNPIIYCYMNARFR 391
            .::...|.|||:..|.||.||.::|..|:
Human   302 LIFLVCHLLAMASTCVNPFIYGFLNTNFK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 38/122 (31%)
7tm_1 122..383 CDD:278431 82/273 (30%)
NPY4RNP_001265723.1 7tm_1 58..322 CDD:278431 82/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.