DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and RGD1560028

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001102709.1 Gene:RGD1560028 / 500157 RGDID:1560028 Length:415 Species:Rattus norvegicus


Alignment Length:375 Identity:104/375 - (27%)
Similarity:173/375 - (46%) Gaps:24/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALC 179
            ||..||.||..|.|:|..:..||||||.||.|||:.|:|:.|||:|.:.:. .:.:.|..|..:|
  Rat    54 IFALALFGNALVVYVVTRSKAMRTVTNIFICSLALSDLLIVFFCIPVTMLQ-NVSDTWLGGAFIC 117

  Fly   180 HFVNYSQAVSVLVSAYTLVAISIDRYIAIMWP--LKPRITKRYATFIIAGVWFIALATALPIPIV 242
            ..|.:.|..:|:....|:..|:::|:..::.|  :|.:.|.:.|..::..||.:|:....|:..|
  Rat   118 KMVPFVQCTAVVTEILTMTCIAVERHQGLVHPFKMKQQYTNQRAFTMLGVVWLVAIIIGSPMWHV 182

  Fly   243 SGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPP 307
            ..|:|.....:.| |...|.|.|.|...:..||..:....|::||.:|...|.:|...:|.|:..
  Rat   183 QRLEIKYDFLYEK-EHICCLEEWSSPVHQKIYTTFILVTLFLLPLLLLSVLYGKIGYELWIKKRV 246

  Fly   308 GEAETNRD------QRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEF-AHWD--PLPY 363
            |:....|.      .::||.|::.|.||:|||::|..||.||:::.:::....| ..:|  .:..
  Rat   247 GDGSVLRTIHGKEMFKIARKKKRAVIMMVTVVVLFAVCWAPFHVVHMMIEYSNFEKEYDEVTIKM 311

  Fly   364 VWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNATSGEMTTKY 428
            ::.....:...:...|||:|..||..|:..||..:       .:|.::.................
  Rat   312 IFAIVQIIGFFNSICNPIVYALMNENFKKNFVSAV-------CYCVIKETPSPAQRHGSLGAIVM 369

  Fly   429 HRHVGDALFRKPKICIRNGSSTSSQSNEHIHHLHQRSSKATSDIFASEPI 478
            ||.|..|:...|   :.........||..|....|...|..|.: ||.|:
  Rat   370 HRRVKLAVGENP---VEIKGEAFGGSNMDIKWCEQPEKKKKSQM-ASCPL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 42/120 (35%)
7tm_1 122..383 CDD:278431 79/271 (29%)
RGD1560028NP_001102709.1 7tm_4 60..>103 CDD:304433 22/42 (52%)
7tm_1 61..331 CDD:278431 79/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.