DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and TkR86C

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:455 Identity:133/455 - (29%)
Similarity:216/455 - (47%) Gaps:72/455 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TTLSGLQFETYNITVMMNFSCDDYDLL-----SEDMWSSAYF-------------KIIVYMLYIP 114
            |||.|....| .:..:::...|:.|.|     ::|..:...|             |.|..:::..
  Fly    29 TTLLGSLNRT-EVVSLLSSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGL 92

  Fly   115 IFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFF-CVPSSFISLFILNY-WPFGLA 177
            :...|:.|||.|.:||.....||||||||:.:|:|.|:|||.. ||   |..:|:||. ||||..
  Fly    93 MMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCV---FNFIFMLNSDWPFGSI 154

  Fly   178 LCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIV 242
            .|...|:...|:|..|.:||||||.||||||:.|||.|.::|....|:..:|  ||:..|..|.:
  Fly   155 YCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLIW--ALSCVLSAPCL 217

  Fly   243 SGLDIPMSPWHTKCEKYICREMW-----PSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVW 302
            ....|....::....:.:|..||     |:...:|.|.|.:..|.:.:|:.|::..|:.:...:|
  Fly   218 LYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLW 282

  Fly   303 AKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQL-LLNDEEFAHWDPLPYVWF 366
            ..|..|| .|:|.....:||||:|:|.:.:|.:|..||||:::..: ..::.:.|....:.:::.
  Fly   283 GSRSIGE-NTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVASTKYVQHMYL 346

  Fly   367 AFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNATSGEMTTKYHRH 431
            .|:|||||:...||:||.:||.|||..|.:::       ..||:.....|.::....:|.|    
  Fly   347 GFYWLAMSNAMVNPLIYYWMNKRFRMYFQRII-------CCCCVGLTRHRFDSPKSRLTNK---- 400

  Fly   432 VGDALFRKPKICIRNGSSTSSQSNEHIHHLHQRSSKATSDIFASEPIIVRRDVTTAVAVISKNKT 496
                          |.|:..::....:.|....||..|:.              |.:||:::..|
  Fly   401 --------------NSSNRHTRGGYTVAHSLPNSSPPTTQ--------------TLLAVLAQTLT 437

  Fly   497  496
              Fly   438  437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 56/122 (46%)
7tm_1 122..383 CDD:278431 97/268 (36%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 106/289 (37%)
7tm_1 100..363 CDD:278431 97/268 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.