DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and NPFR

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster


Alignment Length:431 Identity:111/431 - (25%)
Similarity:192/431 - (44%) Gaps:47/431 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFC 158
            ||.....|.::.:::.| |..:.:|..:||..|...|...|.|||..|.||.:|||.|:|:....
  Fly    76 LSNRAVDSPWYHMLISM-YGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVT 139

  Fly   159 VPSSFISLFILNYWPFGLA--LCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYA 221
            :|.:.:.: :..|||:|..  ||..:...||:.:.||..::.||:.|||..|::|.:..:....|
  Fly   140 MPLTLMEI-LSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGA 203

  Fly   222 TFIIAGVWFIALATALPIPIVSGL---DIPMSPWHTKCEKYI--CREMWPSRTQEYYYTLSLFAL 281
            ..|:||:|.:||..|.|:.:...|   |.|........:..|  |.|.||||...:||::....:
  Fly   204 VTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCV 268

  Fly   282 QFVVPLGVLIFTY--------ARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTC 338
            |::||:.::...|        :|||: |..:....:.:..|.:||.|:.    .:::::.|:|..
  Fly   269 QYLVPILIVSVAYFGIYNKLKSRITV-VAVQASSAQRKVERGRRMKRTN----CLLISIAIIFGV 328

  Fly   339 CWLPFNILQLLLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHR--- 400
            .|||.|...|..:.|.......:...:...|.:.||..|.||::|.::|..||..|.:|:.|   
  Fly   329 SWLPLNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSD 393

  Fly   401 ----MPGLRRWCCLRSVGDRMNATSGEMTTKYHRHVGDALFRKPKICIRNGSSTSSQSNEHIHHL 461
                :.|....|.:::...|......|::.      |:.....|     .|:.:.:...|     
  Fly   394 TNVALNGHTTGCNVQAAARRRRKLGAELSK------GELKLLGP-----GGAQSGTAGGE----- 442

  Fly   462 HQRSSKATSDIFASEPIIVRRDVTTAVAVISKNKTDSPVRR 502
              ....||..:.......:|..:|.:||:...|...|.|.:
  Fly   443 --GGLAATDFMTGHHEGGLRSAITESVALTDHNPVPSEVTK 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 41/122 (34%)
7tm_1 122..383 CDD:278431 81/275 (29%)
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 35/97 (36%)
7tm_1 103..373 CDD:278431 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.