DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and AkhR

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster


Alignment Length:427 Identity:90/427 - (21%)
Similarity:179/427 - (41%) Gaps:74/427 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSEDM-WSSAY-FKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMR--TVTNYFIASLAIGDILM 154
            |::|| ::..: ..|.||.:   :|:.:.|||.||.|:: :..|:|  ...:..:..|||.|:::
  Fly    28 LTKDMVFNDGHRLSITVYSI---LFVISTIGNSTVLYLL-TKRRLRGPLRIDIMLMHLAIADLMV 88

  Fly   155 SFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKR 219
            :...:|...:..:.:.:....| :|..:::.:...:.:|:|.:|.||:|||.||:.|||....: 
  Fly    89 TLLLMPMEIVWAWTVQWLSTDL-MCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKRSYNR- 151

  Fly   220 YATFIIAGVWFIALATALPIPIVSGL-DIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQF 283
             ...::|..|..::..::|...:..| :.|....:.:|   :....:.|...|..|..:.....:
  Fly   152 -GRIMLACAWLGSVVCSIPQAFLFHLEEHPAVTGYFQC---VIFNSFRSDFDEKLYQAASMCSMY 212

  Fly   284 VVPLGVLIFTYARITIRVWAKRP-------PGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWL 341
            ..||.:.|:.|..|.:.::.|..       ......:.|..::|:|::.:||.:|:||||..||.
  Fly   213 AFPLIMFIYCYGAIYLEIYRKSQRVLKDVIAERFRRSNDDVLSRAKKRTLKMTITIVIVFIICWT 277

  Fly   342 PFNILQLLLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRR 406
            |:..:.:....::.:.....|.:..|....|.::.|.||::|...|.|                 
  Fly   278 PYYTISMWYWLDKHSAGKINPLLRKALFIFASTNSCMNPLVYGLYNIR----------------- 325

  Fly   407 WCCLRSVGDRMNATSGEMTTKYHRHVGDALFRKPKICIRNGSSTSSQSNEHIHHLHQRSSKATSD 471
                    .|||..:..:.   :||..          :.|...:|:|       |.|:.      
  Fly   326 --------GRMNNNNPSVN---NRHTS----------LSNRLDSSNQ-------LMQKQ------ 356

  Fly   472 IFASEPIIVRRDVTTAVAVISKNKTDSPVRRSGSSGG 508
             ..:..::..|....|.||.:..|..:.|...|::.|
  Fly   357 -LTNNSLLNGRGQVMAAAVSATTKLANVVSLKGTANG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 31/122 (25%)
7tm_1 122..383 CDD:278431 61/270 (23%)
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.