DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and CCKLR-17D1

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001097021.1 Gene:CCKLR-17D1 / 32860 FlyBaseID:FBgn0259231 Length:673 Species:Drosophila melanogaster


Alignment Length:578 Identity:142/578 - (24%)
Similarity:197/578 - (34%) Gaps:213/578 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DNYQEGYFIRPDPASLIYNTTALP----------ADDEGSNYGYGSTTT--------LSGLQFET 77
            |:.:..:|.....|...|...|||          |.:|.|..|.|.|.|        .|||:.: 
  Fly    68 DHKRASFFGLTIDAFYHYLRQALPLAKEAAIHLNASNEISAVGDGVTITGTPGDLLNYSGLELD- 131

  Fly    78 YNITVMMNFSCDDYDLLSEDMWS-------------------SAYFKIIVYMLYIPIFIFALIGN 123
            ..:.:.:|.   |.||.:....|                   ||...|.|...|..|.:.|::||
  Fly   132 LGLDLDLNL---DMDLATTPSSSTLAPAVTVRTPGNRSVVRVSADVPIWVVPCYSAILLCAVVGN 193

  Fly   124 GTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAV 188
            ..|...:....||||:||.|:.:|||.|||:..||:|.:.:.. :|.::.||..||..:.::||.
  Fly   194 LLVVLTLVQNRRMRTITNVFLLNLAISDILLGVFCMPVTLVGT-LLRHFIFGELLCKLIQFAQAA 257

  Fly   189 SVLVSAYTLVAISIDRYIAIMWPLKPRI--TKRYATFIIAGVWFIALATALPIPIVSGLDIPMSP 251
            ||.||::||||||.:||.||..||:.|.  |..:|..|||.:|..:|....||...|.|.....|
  Fly   258 SVAVSSWTLVAISCERYYAICHPLRSRTWQTINHANKIIAIIWLGSLVCMTPIAAFSQLMPTSRP 322

  Fly   252 WHTKCEKYICREMWPSRTQEY--YYTLSLFALQFVVPLGVLIFTYARITIRVW------------ 302
            ...|     |||.||:.:..|  .|.|.|.....|:||..|.|||..||..::            
  Fly   323 GLRK-----CREQWPADSLNYERAYNLFLDLALLVLPLLALSFTYLFITRTLYVSMRNERAMNFG 382

  Fly   303 -----------------------------------------------------------AKR--- 305
                                                                       :||   
  Fly   383 SSGPEVTTSSSAAVAEAGSQRRANGSHCQSLDTIVPHQHNPHQQHHHHSQYYYDYGHCGSKRRLI 447

  Fly   306 -----------------------------------------------------------PPGEAE 311
                                                                       ..|...
  Fly   448 SGGGPCEGRRHLYCMRSASVKSLRHQQINGGGGTLSGTGAGNGECCSRVHRMRQQMQLQQQGYVS 512

  Fly   312 TNRDQRMA----------------------RSKRKMVKMMLTVVIVFTCCWLP---FNILQLLLN 351
            .|..:|.:                      .||:::|||:..:|:.|..||.|   .|.:.:||.
  Fly   513 DNESRRKSLSQPSLRITEAGLRRSNETKSLESKKRVVKMLFVLVLEFFICWTPLYVINTMTMLLG 577

  Fly   352 DEEFAHWDPLPYVWFAF-HWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWC 408
            ...:.:   :.|...:| ..||.|..|.|||.||:|||.||..||.....|....|.|
  Fly   578 PTVYEY---VGYTSISFLQLLAYSSSCCNPITYCFMNASFRRAFVDTFKGMRVCERLC 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 51/122 (42%)
7tm_1 122..383 CDD:278431 101/423 (24%)
CCKLR-17D1NP_001097021.1 7tm_4 185..>308 CDD:304433 52/123 (42%)
7tm_1 192..>380 CDD:278431 74/193 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.