DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and Tacr1

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_036799.1 Gene:Tacr1 / 24807 RGDID:3811 Length:407 Species:Rattus norvegicus


Alignment Length:368 Identity:119/368 - (32%)
Similarity:176/368 - (47%) Gaps:71/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 STTTLSGLQF--ETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCY 128
            ||.|....||  .|:.|.                :|::||..|:|         .:::||..|.:
  Rat    16 STNTSESNQFVQPTWQIV----------------LWAAAYTVIVV---------TSVVGNVVVIW 55

  Fly   129 IVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVS 193
            |:.:..|||||||||:.:||..:..|:.|....:| :..:.|.|.:||..|.|.|:....::..|
  Rat    56 IILAHKRMRTVTNYFLVNLAFAEACMAAFNTVVNF-TYAVHNVWYYGLFYCKFHNFFPIAALFAS 119

  Fly   194 AYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEK 258
            .|::.|::.|||:||:.||:||::......:|..:|.:||..|.|....|..:       |...:
  Rat   120 IYSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTE-------TMPSR 177

  Fly   259 YICREMW---PSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMAR 320
            .:|...|   |:||.|..|.:.:..|.:.:||.|:.:.|..:.|.:||...||:: ::|......
  Rat   178 VVCMIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDS-SDRYHEQVS 241

  Fly   321 SKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDPLPY-------------VWFAFHWLA 372
            :|||:||||:.||..|..|||||::..|            |||             |:.|..|||
  Rat   242 AKRKVVKMMIVVVCTFAICWLPFHVFFL------------LPYINPDLYLKKFIQQVYLASMWLA 294

  Fly   373 MSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGD 415
            ||...|||||||.:|.|||.||....       |.|...|.||
  Rat   295 MSSTMYNPIIYCCLNDRFRLGFKHAF-------RCCPFISAGD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 40/120 (33%)
7tm_1 122..383 CDD:278431 93/276 (34%)
Tacr1NP_036799.1 7tm_1 54..305 CDD:278431 90/271 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.