DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and Npffr1

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001170982.1 Gene:Npffr1 / 237362 MGIID:2685082 Length:432 Species:Mus musculus


Alignment Length:364 Identity:119/364 - (32%)
Similarity:172/364 - (47%) Gaps:54/364 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SAYFK---------IIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSF 156
            |:|::         |..|.|   ||:..::||..||:||.....||||||.||.:||:.|:|:..
Mouse    33 SSYYQHSSPVAAMFIAAYAL---IFLLCMVGNTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGI 94

  Fly   157 FCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYA 221
            ||:|::.:...|.. |||..|.|......|.:||..|.:|||||:::|:..|:.|.:.::|.|.|
Mouse    95 FCMPTTLVDNLITG-WPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKA 158

  Fly   222 TFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEK-------YICREMWPSRTQEYYYTLSLF 279
            ...||.:|.:||....|..:.  |.:.....|...:.       |.|.|.||.:.....||..||
Mouse   159 LLTIAVIWALALLIMCPSAVT--LTVTREEHHFMLDARNRSYPLYSCWEAWPEKGMRKVYTAVLF 221

  Fly   280 ALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQ-----RMARSKRKMVKMMLTVVIVFTCC 339
            |..::.||.:::..||||..::.  :.||.|....:.     |.:|.:.::|.|::.|.:.||..
Mouse   222 AHIYLAPLALIVVMYARIARKLC--QAPGPARDAEEAVAEGGRASRRRARVVHMLVMVALFFTLS 284

  Fly   340 WLPFNILQLLLNDEEFAHWDPLPYVWFAF---HWLAMSHCCYNPIIYCYMNARFRSGF------- 394
            |||..:|.||::..|.:.........:||   ||||..|...|||||.|.|..||.||       
Mouse   285 WLPLWVLLLLIDYGELSELQLHLLSVYAFPLAHWLAFFHSSANPIIYGYFNENFRRGFQAAFRAQ 349

  Fly   395 ---------VQLMHRMPG--LRRWCCLRSVGDRMNATSG 422
                     .|.....||  |||    |.|.|...:.||
Mouse   350 LCWLPWAAHKQAYSERPGRLLRR----RVVVDVQPSDSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 48/120 (40%)
7tm_1 122..383 CDD:278431 93/275 (34%)
Npffr1NP_001170982.1 7tm_4 54..>173 CDD:304433 48/119 (40%)
7tm_1 60..331 CDD:278431 93/275 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8802
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.