DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and Tacr2

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_033340.3 Gene:Tacr2 / 21337 MGIID:98477 Length:384 Species:Mus musculus


Alignment Length:405 Identity:131/405 - (32%)
Similarity:203/405 - (50%) Gaps:47/405 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSNYGYGSTTTLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGN 123
            |::.....|..||||:.....:|.   ||...:.|.   :|::||..::         :.|:.||
Mouse     2 GAHASVTDTNILSGLESNATGVTA---FSMPGWQLA---LWATAYLALV---------LVAVTGN 51

  Fly   124 GTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAV 188
            .||.:|:.:..||||||||||.:||:.|:.|:.|....:|| ....|.|.||...|:|.|.....
Mouse    52 ATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFI-YASHNIWYFGSTFCYFQNLFPVT 115

  Fly   189 SVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWH 253
            ::.||.|::.||:.|||:||:.|.:||::......:||.:|.:|||.|.|....|.:.:....  
Mouse   116 AMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGA-- 178

  Fly   254 TKCEKYICREMWPSRT---QEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRD 315
            |||.     ..||:..   ....|.|.:|.|.:.:||.|:...|:.|.:.:|.:..|.......:
Mouse   179 TKCV-----VAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGAN 238

  Fly   316 QRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP-LPYVWFAFHWLAMSHCCYN 379
            .|..::|:|.||.|:.||:.|..||||:::..:|...:|..::.. :..|:.|..|||||...||
Mouse   239 LRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSSTMYN 303

  Fly   380 PIIYCYMNARFRSGFVQLMHRMPGLRRWCC---LRSVGDRMNAT-SGEMTTKYHR-HVGDALFRK 439
            |||||.:|.|||||| :|..|       ||   ..:..||:..| :..::.:.:| |..:.||  
Mouse   304 PIIYCCLNHRFRSGF-RLAFR-------CCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLF-- 358

  Fly   440 PKICIRNGSSTSSQS 454
                 ..|..|.|::
Mouse   359 -----MTGDMTHSEA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 47/120 (39%)
7tm_1 122..383 CDD:278431 93/264 (35%)
Tacr2NP_033340.3 7tm_4 42..>168 CDD:304433 51/135 (38%)
7tm_1 50..307 CDD:278431 93/264 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..384 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.