DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and Npy4r

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_032945.3 Gene:Npy4r / 19065 MGIID:105374 Length:375 Species:Mus musculus


Alignment Length:357 Identity:98/357 - (27%)
Similarity:159/357 - (44%) Gaps:49/357 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSNYGYGSTTTLSGLQFETYNITVMMNFS--CDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALI 121
            ||..|...|..|..          ..|||  |.|          ||.....:...|....|..::
Mouse    13 GSLQGKNGTNPLDS----------PYNFSDGCQD----------SAELLAFIITTYSIETILGVL 57

  Fly   122 GNGTVCYIVYSTPRMR---TVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVN 183
            ||  :| :::.|.|.:   .|||..||:||..|.||...|.|.: ::..|::||.||..||..:.
Mouse    58 GN--LC-LIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLT-VTYTIMDYWIFGEVLCKMLT 118

  Fly   184 YSQAVSVLVSAYTLVAISIDRYIAIMWPL--KPRITKRYATFIIAGVWFIALATALPIPIVSGLD 246
            :.|.:||.||..:||.::::|:..|:.|.  ||.|.:.|...::  :||::...:||....|.|:
Mouse   119 FIQCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVV--IWFVSCFLSLPFLANSTLN 181

  Fly   247 IPMSPWHTKC-----EKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRP 306
            ......|:|.     :|.:|...|.|......||..|...|:.:||..::..|.||..|:..::.
Mouse   182 DLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQRLQRQKH 246

  Fly   307 PGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDPLP-----YVWF 366
            ...|.....:  |...:::..|::|:|..|...|||.::...|    |..:.:.:|     .::.
Mouse   247 VFHAHACSSR--AGQMKRINSMLMTMVTAFAVLWLPLHVFNTL----EDWYQEAIPACHGNLIFL 305

  Fly   367 AFHWLAMSHCCYNPIIYCYMNARFRSGFVQLM 398
            ..|.|||:..|.||.||.::|..|:.....|:
Mouse   306 MCHLLAMASTCVNPFIYGFLNINFKKDIKALV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 41/125 (33%)
7tm_1 122..383 CDD:278431 79/275 (29%)
Npy4rNP_032945.3 7tm_4 52..>174 CDD:304433 42/127 (33%)
7tm_1 58..322 CDD:278431 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.