DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and C30B5.7

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_495243.1 Gene:C30B5.7 / 183043 WormBaseID:WBGene00016248 Length:350 Species:Caenorhabditis elegans


Alignment Length:240 Identity:45/240 - (18%)
Similarity:81/240 - (33%) Gaps:90/240 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MLRNEDDNYQEGYFIRPDPASLIYNTTALPADDEGSNY-----GYGSTTTLSGLQFETYNITVMM 84
            ::...|..:..|.|.|.:..    ||:.....::...|     ..|:.:||       .|..:|:
 Worm     3 LINTSDQAFNSGMFTRNETV----NTSVTHGFEDLITYHIVNTSLGAISTL-------VNTLLMI 56

  Fly    85 NFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVT--------- 140
            .|       |....:.:.|..:|:..:...|...|::..|.....:||| .:||:|         
 Worm    57 IF-------LGYRPFRTRYVLLILLNVGDLINSMAIVLTGLNRIELYST-AIRTMTLPVRTSVEC 113

  Fly   141 ---NYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISI 202
               .:.|..| |||||     :|.|       .:|                           :.:
 Worm   114 AIEPWLILKL-IGDIL-----IPVS-------TFW---------------------------MGV 138

  Fly   203 DRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDI 247
            :|.:||::|:       :..|.:.|       .|:...:|.||.:
 Worm   139 ERLVAILFPI-------FYRFSVDG-------KAVKYLVVPGLSL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 25/132 (19%)
7tm_1 122..383 CDD:278431 27/138 (20%)
C30B5.7NP_495243.1 7tm_4 <136..315 CDD:304433 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.