DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and npr-11

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_508234.2 Gene:npr-11 / 182921 WormBaseID:WBGene00016110 Length:402 Species:Caenorhabditis elegans


Alignment Length:390 Identity:114/390 - (29%)
Similarity:182/390 - (46%) Gaps:61/390 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 MNFSCDDY--------------DLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTP 134
            :|.|||:|              .:::...:|...|...:...|:.|.:|..|||.....:|...|
 Worm     4 VNESCDNYVEIFNKINYFFRDDQVINGTEYSPKEFGYFITFAYMLIILFGAIGNFLTIIVVILNP 68

  Fly   135 RMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNY--WPFGLALCHFVNYSQAVSVLVSAYTL 197
            .|||..|:||.:||:.|.   |.|:.::..:|:.:.|  |||...||......|..::.:|.:::
 Worm    69 AMRTTRNFFILNLALSDF---FVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQGFNIFLSTFSI 130

  Fly   198 VAISIDRYIAIMWPLKPRITKR-------YATFIIAGVWFIALATALPIPIVSGL-DIPMSPWHT 254
            .:|::|||:.|::|     |||       :..||:  :|.|:|..|:|:...|.| .:.:.|   
 Worm   131 ASIAVDRYVLIIFP-----TKRERQQNLSFCFFIM--IWVISLILAVPLLQASDLTPVFVEP--- 185

  Fly   255 KCE--KYIC---REMWPSR-TQEYYYTLSLFALQFVVPLGVLIFTYARITIRV---WAKRPPG-E 309
            .|:  .|||   .|:|... ..:..|||::...|:..||..|:|.|:||..|:   :|.|... .
 Worm   186 SCDLALYICHEQNEIWEKMIISKGTYTLAVLITQYAFPLFSLVFAYSRIAHRMKLRFANRNQNVT 250

  Fly   310 AETNRDQR---MARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDPLPYVWFAF-HW 370
            ..||..||   :...:|:...:::.||.||...|||.|:..:.   ..|...:......|:. |.
 Worm   251 TNTNTSQRRRSVVERQRRTHLLLVCVVAVFAVAWLPLNVFHIF---NTFELVNSFSVTTFSICHC 312

  Fly   371 LAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSV--GDRMNATSGEMTTKYHRHVG 433
            |||...|.||:||.:.|..||..|:.|..|: |||   .||.|  |:: .:....|.|::....|
 Worm   313 LAMCSACLNPLIYAFFNHNFRIEFMHLFDRV-GLR---SLRVVIFGEQ-ESLKKSMRTEFRSRGG 372

  Fly   434  433
             Worm   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 40/129 (31%)
7tm_1 122..383 CDD:278431 85/284 (30%)
npr-11NP_508234.2 7tm_4 48..>192 CDD:304433 47/156 (30%)
7tm_1 56..325 CDD:278431 85/284 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.