DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and Npy6r

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_035065.1 Gene:Npy6r / 18169 MGIID:1098590 Length:371 Species:Mus musculus


Alignment Length:338 Identity:100/338 - (29%)
Similarity:170/338 - (50%) Gaps:47/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SSAYFK-----------IIVYMLYIPIFIFALIGNGTVCYIVYSTPR-MRTVTNYFIASLAIGDI 152
            :||:|.           :::.:.|..|.|..:.||.::..|::...| .:.|||..||:|::.||
Mouse    19 NSAFFYFESCQPPFLAILLLLIAYTVILIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDI 83

  Fly   153 LMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWP--LKPR 215
            |:...|:|.:.| ..::::|.||..:|...:|.|:|||.||.::||.|:|:||..|:.|  .|||
Mouse    84 LVCVMCIPFTVI-YTLMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPR 147

  Fly   216 ITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHT-------KCEKYICREMWPSRTQEYY 273
            :...|...|:  :|.|:|  .|.||:.....:...|:|.       ...:..|.|:|||:..:..
Mouse   148 VAHAYWGIIL--IWLISL--TLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLL 208

  Fly   274 YTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTC 338
            ::.|||.||:.||||.::..|.:|.:.:..:....:.......|:..:||..| |::::|:.|..
Mouse   209 FSTSLFMLQYFVPLGFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNV-MLISIVVTFGA 272

  Fly   339 CWLPFNIL--------QLLLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFV 395
            ||||.||.        ::|::    .|.|   .|:...|.:||...|.||:.|.::|..|:...:
Mouse   273 CWLPLNIFNVIFDWYHEMLMS----CHHD---LVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLM 330

  Fly   396 QLMHRMPGLRRWC 408
            .|:|..     ||
Mouse   331 MLIHHC-----WC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 44/123 (36%)
7tm_1 122..383 CDD:278431 87/278 (31%)
Npy6rNP_035065.1 7tm_4 46..>95 CDD:304433 16/48 (33%)
7tm_1 52..318 CDD:278431 87/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.