DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and npy2rl

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_017948295.1 Gene:npy2rl / 100494553 XenbaseID:XB-GENE-922375 Length:372 Species:Xenopus tropicalis


Alignment Length:350 Identity:120/350 - (34%)
Similarity:185/350 - (52%) Gaps:41/350 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PADDEGSNYGYGSTT--TLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIF 116
            |.::.||. |..|.:  |..|..      |:||     ||..|       ...::|:...|..|.
 Frog     9 PTEELGSR-GLHSKSMHTFHGAH------TIMM-----DYTKL-------VGVQVILIAAYSLII 54

  Fly   117 IFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHF 181
            :..|:||..|.|::.....||||||:|||:|||.|:::..||:|.:.: ..:::.|.||..|||.
 Frog    55 LLGLVGNSLVIYMIVKYKNMRTVTNFFIANLAIADLMVDSFCLPFTLV-YTLMDEWKFGSVLCHL 118

  Fly   182 VNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGL- 245
            ..|:||:||.||..||:.|::|||..|::.|..||:|..:..||:..|..|...|:|:.:.... 
 Frog   119 FPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFR 183

  Fly   246 --DIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPG 308
              |:|  |::.|..  :|.|.|.:| ....|:||:..||:.:||.|:.:.|    :|:|.|....
 Frog   184 YEDLP--PFNLKIA--VCAENWTNR-DSTIYSLSMLILQYALPLAVICYAY----LRIWFKLKNH 239

  Fly   309 EAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFA---HWDPLPYVWFAFHW 370
            .:.|.|.:...| ::...||::.:|:||..|||||:|.||.: |.|:.   |.:.|.|.  .||.
 Frog   240 ISPTTRSESQQR-RKNTTKMLVMMVVVFAVCWLPFHIFQLAI-DLEWTVAIHENKLLYT--IFHV 300

  Fly   371 LAMSHCCYNPIIYCYMNARFRSGFV 395
            :||.....||.:|.:||..:|.||:
 Frog   301 VAMCSTFVNPFLYGWMNKNYRHGFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 50/120 (42%)
7tm_1 122..383 CDD:278431 97/266 (36%)
npy2rlXP_017948295.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134608
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24238
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.