DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and tacr3

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_002934808.1 Gene:tacr3 / 100486525 XenbaseID:XB-GENE-985728 Length:431 Species:Xenopus tropicalis


Alignment Length:405 Identity:128/405 - (31%)
Similarity:198/405 - (48%) Gaps:57/405 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 MWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSS 162
            :||.||..::.         .|:.||..|.:|:.:..|||||||||:.:||..|..|:.|....:
 Frog    51 LWSLAYGSMVA---------VAVFGNIIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVN 106

  Fly   163 FISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAG 227
            || ..:.|.|.||.|.|.|.|:....|:..|.|::.||::|||:||:.|||||::......:|..
 Frog   107 FI-YALHNEWYFGEAYCRFHNFFPITSIFASIYSMSAIAVDRYMAIIDPLKPRLSATSTKVVIGS 170

  Fly   228 VWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIF 292
            :|..|:..|.|..:.|.:.:..:       :.:|..:||.:.:...|...|..|.:|:||.|:..
 Frog   171 IWIFAILLAFPQCLYSKIRVTRT-------RTLCMLVWPGKDERLTYQFILVLLVYVLPLIVMGV 228

  Fly   293 TYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLL-LNDEEFA 356
            ||..:.|.:|....||:......::: |:|||:||||:.||:.|..||||::|..|. ..|.:..
 Frog   229 TYTIVGITLWGGEIPGDTSDKYHEQL-RAKRKVVKMMIVVVVTFAICWLPYHIFFLADALDIKLD 292

  Fly   357 HWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVG--DRMNA 419
            .|..:..::.|..|||||...|||||||.:|.|||:||.:..       |||....|.  |.:..
 Frog   293 RWKYIQQIYLAIFWLAMSSTMYNPIIYCCLNKRFRAGFKRAF-------RWCPFIEVSSYDELEL 350

  Fly   420 TSGEMTTKYHRHVGDALF--------------------RKPKICIRNGSSTSSQSNEHIHHLHQR 464
            .|    |::|.....:|:                    .||....:..::||..:   .:...:|
 Frog   351 KS----TRFHPTRQSSLYTVSRMESSMTVVFDPNDVENNKPSHSHKKRAATSEST---FNGCSRR 408

  Fly   465 SSK--ATSDIFASEP 477
            :||  :|:..|.|.|
 Frog   409 NSKSASTNSSFISSP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 47/120 (39%)
7tm_1 122..383 CDD:278431 94/261 (36%)
tacr3XP_002934808.1 7tm_4 58..>181 CDD:304433 48/132 (36%)
7tm_1 66..319 CDD:278431 94/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.