DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RYa-R and qrfpra

DIOPT Version :9

Sequence 1:NP_001287552.1 Gene:RYa-R / 43253 FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_021336543.1 Gene:qrfpra / 100149491 ZFINID:ZDB-GENE-090313-105 Length:422 Species:Danio rerio


Alignment Length:432 Identity:116/432 - (26%)
Similarity:198/432 - (45%) Gaps:75/432 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YDLLSEDMWSSAYFKIIVY-------------MLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNY 142
            |:|..::...:...:.:||             ::|..||:.||:||..|.|||.....::|.||.
Zfish    18 YNLTRQEFIETYQIEPLVYIPELPAGAKTTFVIVYTVIFLLALVGNSVVVYIVLRKRGIQTATNI 82

  Fly   143 FIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIA 207
            ||.|||:.|:|:||||:|.:.:. .|.:.|..|:.:|..|.:.|..:|:....|:..|:::||..
Zfish    83 FICSLAVSDLLISFFCIPFTLLQ-NISSEWFGGVLVCKTVPFVQTTAVVTGILTMTCIAVERYQG 146

  Fly   208 IMWPL--KPRITKRYATFIIAGVWFIALATALPIPIVSGLDIP---MSPWHTKCEKYICREMWPS 267
            |:.||  |.:.|.:.|..::..||..|:....|:..|..|::.   :...|..|    |:|.|.|
Zfish   147 IVHPLKIKRQCTPQRAYRMLGVVWIAAMMVGSPMLFVQQLEVKYDFLYDNHHVC----CQERWRS 207

  Fly   268 RTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGE-----AETNRD-QRMARSKRKMV 326
            ......|...:....|::||..::..|.||.|.:|.::..|:     |...|: .::||.||:.:
Zfish   208 SAHRKRYATFILVFLFLLPLAAMLILYTRIGIELWIRKQVGDSSVLNAMNQREVSKIARKKRRAI 272

  Fly   327 KMMLTVVIVFTCCWLPFNILQLLLNDEEFAH----WDPLP--YVWFAFHWLAMSHCCYNPIIYCY 385
            |||:|:|::||.||.||:.:.:|.   |:::    :|.:.  .:......:..|:...|||||.:
Zfish   273 KMMVTIVVLFTVCWAPFHTVHILF---EYSYLNKKYDDVTVNMIIAVAQAIGFSNSFNNPIIYAF 334

  Fly   386 MNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNATSGEMTTKYHRHVGDALFRKPKICIRNGSST 450
            ||..|:...:..:.        .|:|....|::.          :.....||.|          :
Zfish   335 MNENFQKNCMSTLS--------VCIRRSSHRVDV----------KDKSKVLFCK----------S 371

  Fly   451 SSQSNE-----HIHHLHQ----RSSKATSDIFASEPIIVRRD 483
            :.|..|     .||.:.|    ||:..||..|..|.:.|..:
Zfish   372 ARQDEEISVMPRIHIIDQVQYARSNMRTSMSFLEERMSVENN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 45/122 (37%)
7tm_1 122..383 CDD:278431 84/277 (30%)
qrfpraXP_021336543.1 7tmA_QRFPR 46..343 CDD:320333 94/304 (31%)
TM helix 1 47..73 CDD:320333 11/25 (44%)
TM helix 2 80..106 CDD:320333 14/26 (54%)
TM helix 3 118..148 CDD:320333 8/29 (28%)
TM helix 4 161..182 CDD:320333 5/20 (25%)
TM helix 5 211..236 CDD:320333 5/24 (21%)
TM helix 6 266..296 CDD:320333 14/29 (48%)
TM helix 7 311..336 CDD:320333 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.