DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:293 Identity:93/293 - (31%)
Similarity:137/293 - (46%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AEEWME-----------AQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTK-SISKSNFNPAH 100
            ||.|..           :.||:..|        |.|:|.:||::.:.:..:.. :|..|||..|.
  Rat    31 AEPWAGTAIRPLKLLPWSPEKINTR--------FLLYTNENPTAFQTLQLSDPLTIGASNFQVAR 87

  Fly   101 PTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMIN 165
            .|||:|||:......:...|:.|......:.|.|.|||.:.....|..:...|...|.:||:||:
  Rat    88 KTRFIIHGFIDKGEENWVVDMCKNMFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMID 152

  Fly   166 FLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWY 230
            .|..|:..:.:.|::|||||||||||.||..|.| :..|.||||....|.......||:..||.:
  Rat   153 ILVKNYSYSPSKVHLIGHSLGAHVAGEAGSRTPG-LGRITGLDPVEANFEGTPEEVRLDPSDADF 216

  Fly   231 VESIQTNGGTL------GFLKPIGKGAFYPNGGKTQPGCP-------LDVTG---------ACSH 273
            |:.|.|:...|      |..:..|...|:||||::.|||.       :|:.|         ||:|
  Rat   217 VDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNH 281

  Fly   274 GRSTTYYAEAV-SEDNFGTMKCGDYEEAVAKEC 305
            .||..||.|:: :.|.|....|..|::..:.:|
  Rat   282 LRSYKYYLESILNPDGFAAYPCASYKDFESNKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 89/273 (33%)
Pancreat_lipase_like 68..333 CDD:238363 87/262 (33%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 93/293 (32%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.