DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG34447

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:138/280 - (49%) Gaps:14/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VNFYLF---TPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKG 129
            ::|:|:   |.:||     |......::..||.|..|.:.:|||:|.....:.||.||...|...
  Fly    42 ISFWLYSNSTRENP-----ILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHE 101

  Fly   130 DYNVIVVDWA-RARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYA 193
            |..||.:|:. ..|...|..:|..:....:.:|::||.|.|...:..:.:::||.|||..|||..
  Fly   102 DVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQT 166

  Fly   194 GKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGK 258
            ......::..|.|||||.|||.....::||:..||.:|:.|.|:....|:|:..|...||||.|.
  Fly   167 ANYVKRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGA 231

  Fly   259 TQPGC---PLDVTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVAKECGSTYSSVRMGADTN 319
            .||||   .:....:|:|.|:..:|||:::.. .|...:|..:...:...|.:|.:...:|...:
  Fly   232 KQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQALLGYHVS 296

  Fly   320 AYMVEGDFYVPVNSKAPFGM 339
            ..: .|.:::...||:|:.:
  Fly   297 DEL-RGSYFLQTASKSPYAL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 81/276 (29%)
Pancreat_lipase_like 68..333 CDD:238363 79/272 (29%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 79/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.