DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and PNLIP

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:279 Identity:92/279 - (32%)
Similarity:135/279 - (48%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GLTTVPVN------------FYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYL 114
            |:|..|::            |.|:|.:||::.:.:.|.:.|||.|||.....|||:|||:.....
Human    35 GITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGE 99

  Fly   115 NSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVY 179
            .:..:::.|........|.|.|||.......|..:...:...|.:||..:.||:...|.:.::|:
Human   100 ENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVH 164

  Fly   180 VIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL--- 241
            |||||||||.||.||:.|:|.:..|.|||||.|.|.......||:..||.:|:.|.|:|..:   
Human   165 VIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPN 229

  Fly   242 ---GFLKPIGKGAFYPNGGKTQPGCP-------LDVTG---------ACSHGRSTTYYAEA-VSE 286
               |..:.:|...|:||||...|||.       :|:.|         ||:|.||..||.:: |:.
Human   230 LGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNP 294

  Fly   287 DNFGTMKCGDYEEAVAKEC 305
            |.|....|..|....|.:|
Human   295 DGFAGFPCASYNVFTANKC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 92/279 (33%)
Pancreat_lipase_like 68..333 CDD:238363 89/273 (33%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 92/279 (33%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145316
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.