DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and LPL

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:329 Identity:95/329 - (28%)
Similarity:155/329 - (47%) Gaps:46/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WMEAQEKLEG--------RGLTTVPVNFYLFTPKNPSSSK-H-IYATTKSISKSNFNPAHPTRFV 105
            |:::.....|        |....:...|.|.||::.:... | |....:|::..:||.:..|..|
Human    14 WLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMV 78

  Fly   106 IHGWT-----QSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMIN 165
            |||||     :|::..:   :...:..:.|.|||||||.......|..|.......|:.||:.||
Human    79 IHGWTVTGMYESWVPKL---VAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN 140

  Fly   166 FLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWY 230
            ::::.....|::|:::|:|||||.||.||..|:.:|:.|.|||||.|.|.|.:...||:.|||.:
Human   141 WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADF 205

  Fly   231 VESIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGC---------------PLDVTGACSHGR 275
            |:.:.|     .|.::|..||:|....|||||..||||               .:|....|||.|
Human   206 VDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHER 270

  Fly   276 STTYYAEA-VSEDN-FGTMKCGD---YEEAVAKECGSTYSSVRMGADTNAYMVE--GDFYVPVNS 333
            |...:.:: ::|:| ....:|..   :|:.:...|.....: .:|.:.|....:  ...|:...|
Human   271 SIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCN-NLGYEINKVRAKRSSKMYLKTRS 334

  Fly   334 KAPF 337
            :.|:
Human   335 QMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 93/321 (29%)
Pancreat_lipase_like 68..333 CDD:238363 90/298 (30%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53 5/20 (25%)
Lipase 33..473 CDD:332983 92/310 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 2/22 (9%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7604
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.