DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and LIPC

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:333 Identity:94/333 - (28%)
Similarity:155/333 - (46%) Gaps:52/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VAEE--WMEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGW 109
            |:||  ...||.....:.|..:...|.||...|......| ....::.:..||.:.|...:||||
Human    39 VSEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRI-NHPDTLQECGFNSSLPLVMIIHGW 102

  Fly   110 T-----QSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKD 169
            :     ::::..|.:.::..  .....||.:|||.......|..:|......||:||.::.:|::
Human   103 SVDGVLENWIWQMVAALKSQ--PAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRWLEE 165

  Fly   170 NHGLNLNDVYVIGHSLGAHVAGYAGKNTDG--QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVE 232
            :..|:.:.|::||:||||||:|:||.:..|  ::..|.|||.|.|||..:.|:.||:.|||.:|:
Human   166 SVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVD 230

  Fly   233 SIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGC---------------PLDVTGACSHGRST 277
            :|.|     .|.::|..:|||...||||||..||||               .:..|..|||.||.
Human   231 AIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSV 295

  Fly   278 TYYAEAVSEDNFGTM--KCGD---YEEAVAKECGSTYSSVRMG-ADTNAYMVEGD-------FYV 329
            ..:.:::......:|  .|||   :.:.:...|       :.| .:|..|.|..:       .::
Human   296 HLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSC-------KKGRCNTLGYHVRQEPRSKSKRLFL 353

  Fly   330 PVNSKAPF 337
            ...:::||
Human   354 VTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 87/319 (27%)
Pancreat_lipase_like 68..333 CDD:238363 86/304 (28%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.