DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG10116

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:274 Identity:81/274 - (29%)
Similarity:134/274 - (48%) Gaps:24/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVI 134
            |:|.|.:...:::.|.|..:::.:|:|..|.||...|..|..:..:.....:..|.|.:.|.|:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   135 VVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVA-GYAGK--- 195
            .||.:.|..   .|.::      ..||.::..|.:...:.|:.:.|:|.:.|||:| |.|.|   
  Fly    89 SVDLSEAND---ETEII------DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQ 144

  Fly   196 NTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQ 260
            :...|:..|..|||:    |..:.:.:|:..||.:||.:.||.|..|..:.:|...:|||||:||
  Fly   145 DLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQ 205

  Fly   261 PGCPLDVTGACSHGRSTTYYAEAVS-EDNFGTMKCGDYEEAVAKECGSTYSSVRMG-ADTNAYMV 323
            |||   .|.:|||.|:....||..| |::|.:.:||..|...|..|  .:|:.:|| ........
  Fly   206 PGC---TTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEEEQPA 265

  Fly   324 EGDFYVPVNSKAPF 337
            .|.:::.....:||
  Fly   266 SGIYFLETRQSSPF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 79/272 (29%)
Pancreat_lipase_like 68..333 CDD:238363 79/268 (29%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.