DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and lipca

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:276 Identity:74/276 - (26%)
Similarity:128/276 - (46%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SISKSNFNPAHPTRFVIHGWT-----QSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATS 149
            ::....||.:.|...:||||:     :.:::.:.|.::.   |:|:.||::.||.......|..:
Zfish    68 TLDACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKS---SEGNINVLIADWLTLAHQHYPIA 129

  Fly   150 VMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHT---IIGLDPAL 211
            .......|:.:|.::::|:|.....|..|::||:|||||::|:||.|......|   |.|||||.
Zfish   130 AQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYSLGAHISGFAGSNLAMSGRTLGRITGLDPAG 194

  Fly   212 PLFSYNKPNKRLNSDDAWYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKTQPGCPL------ 265
            |:|.......||:.:||.:|::|.|     .|.::|..:|:....||||||..||||.|      
Zfish   195 PMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGGSFQPGCQLHMQNIY 259

  Fly   266 -----------DVTGACSHGRSTTYYAEAV--SEDNFGTMKCGD---YEEAVAKEC--------G 306
                       :.|..|:|.|:...:.:::  .:......||.|   :::....:|        |
Zfish   260 AHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDCRKNRCNTLG 324

  Fly   307 STYSSVRMGADTNAYM 322
            .....||.|.....::
Zfish   325 YDIKKVRTGKSKRLFL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 74/276 (27%)
Pancreat_lipase_like 68..333 CDD:238363 74/276 (27%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 74/276 (27%)
Pancreat_lipase_like 54..344 CDD:238363 74/276 (27%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.