DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and lipg

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:286 Identity:86/286 - (30%)
Similarity:144/286 - (50%) Gaps:48/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KSISKSNFNPAHPTRFVIHGWT-----QSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYAT 148
            :||....||....|..:|||||     :|:::.:.:.:::   .:.:.||:||||....:..|..
Zfish    76 ESIVACGFNATLRTILIIHGWTMSGMFESWMHKLVAAVQR---RESEANVVVVDWLGLANQLYPD 137

  Fly   149 SVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPL 213
            :|......|:.:|.::::|::...|.|.:|::||:|||||||||||...:|.:..|.|||||.|:
Zfish   138 AVNHTRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGIIGRITGLDPAGPM 202

  Fly   214 F----SYNKPNKRLNSDDAWYVESIQTN-----GGTLGFLKPIGKGAFYPNGGKTQPGCPLD--- 266
            |    ||||    |:.|||.:|:.:.|.     |.::|..:|||....|||||..||||...   
Zfish   203 FEGADSYNK----LSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFL 263

  Fly   267 --VTG------ACSHGRSTTYYAEA-VSEDNFG-TMKC---GDYEEAVAKECGST------YSSV 312
              .:|      .|.|.|:...:.:: :::|:.. ..:|   ..:::.:...|...      |::.
Zfish   264 SAASGNFMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNSIGYNAK 328

  Fly   313 RMGADTNAYMVEGDFYVPVNSKAPFG 338
            :|....|:.|     |:...:..|||
Zfish   329 KMRKRRNSKM-----YLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 83/283 (29%)
Pancreat_lipase_like 68..333 CDD:238363 83/279 (30%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 86/286 (30%)
Pancreat_lipase_like 65..344 CDD:238363 83/279 (30%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.