DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG10163

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:375 Identity:93/375 - (24%)
Similarity:150/375 - (40%) Gaps:77/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEE-----WMEAQEKLEGRGLT 64
            :|:|: .|...:.|:|:.::...      |....|.:..::.:..|     |         |...
  Fly    14 MIIAV-CLICQSLAVEDKDKATN------PLNIDSVQKHNVKLLSEQLNRGW---------RAFC 62

  Fly    65 TVPVN---FYLFTPKNPSSSK-HIYATT--------KSISK---SNFNPAHPTRFVIHGW--TQS 112
            ..||:   ..||...|||.:: |:...|        ||||:   .:.||...|...::.:  ..|
  Fly    63 DAPVDEGVMSLFQGINPSDARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIYVNAFHTADS 127

  Fly   113 YLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAV----AATGKKVAKMINFLKDNHGL 173
            |. |:...:.....|:.|.||||||:|:    |.|....||    :..|..|.|::..||| .|:
  Fly   128 YF-SVQEHLTLLQNSRRDLNVIVVDFAK----DVAQLYYAVRHHLSVNGYFVYKLLRALKD-AGI 186

  Fly   174 NLNDVYVIGHSLGAHVAGYA----GKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESI 234
            .:.|:.:.|||:||::|...    .|.....|..::.:|||.   .....:..:....|..|..:
  Fly   187 AVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPAT---MCRTTDILVKQSVALRVVVL 248

  Fly   235 QTNGGTLGFLKPIGKGAFYPNG------GKTQPGCPLDVTGACSHGRSTTYYAEAVSEDNFGTM- 292
            ...|...|...|:|....||||      .|.||||...:   |||......:.||:.|   |.| 
  Fly   249 HGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI---CSHMYPFILFMEALIE---GVMI 307

  Fly   293 ---KCGDYEEAVAKECGSTYSSVRMGA--DTNAYMVEGDFYVPVNSKAPF 337
               ||..:.:....:| :..:::.:|.  ..||   :|.::.......||
  Fly   308 PATKCESWAKFRQGDC-NFQNTINIGLIYPANA---KGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 82/316 (26%)
Pancreat_lipase_like 68..333 CDD:238363 80/301 (27%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.