DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG10357

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:265 Identity:88/265 - (33%)
Similarity:139/265 - (52%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFL 167
            :.::||:..|..:.....:|.|:.::|..||:|.||....::||.:|.:||....:.:||::...
  Fly    56 KLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEF 120

  Fly   168 KDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVE 232
            ...||::|..|:|||||||||:||..|:..:|.:..:.|||||||||| ::.:..|:|:.|.:|:
  Fly   121 LQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFS-SRSDDSLHSNAAQFVD 184

  Fly   233 SIQTNGGTLGFLKPIGKGAFYPNGG-KTQPGCP-LDVTGA---------CSHGRSTTYYAEAVS- 285
            .|.|:....|.::|.|...||||.| ..||||. :||..|         |||.|:..:|||::. 
  Fly   185 VIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGM 249

  Fly   286 EDNFGTMKCG-------DYEEAVAK------ECGSTYSSVRMGADTN----AYMVEGDFYVPVNS 333
            .:||..:.|.       ..|:.:.:      |..:.|.:|.||...|    .|     :|:..|.
  Fly   250 PENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLY-----YYLETNG 309

  Fly   334 KAPFG 338
            ..|:|
  Fly   310 APPYG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 86/262 (33%)
Pancreat_lipase_like 68..333 CDD:238363 85/258 (33%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.