DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG13562

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:315 Identity:65/315 - (20%)
Similarity:112/315 - (35%) Gaps:65/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNS 119
            |::::.....|:.|.||....|...:|  .|.....:|.|..:|......|:|||.||..:....
  Fly    50 QQRIKYDAQKTMKVMFYKNNTKTMETS--AYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWAL 112

  Fly   120 DI--RKAFLSKGDYNVIVVDWARARSVDYATSVMAV-----AATGKKVAKMINFLKDNHGLNLND 177
            .:  |.::...|  .||.:|:    ||..::|.|.:     ..||...:.::...:  .|.:...
  Fly   113 SLIERLSYYRGG--CVICIDY----SVVASSSYMRLYTNFDTLTGAISSIILTLFR--QGFDPKR 169

  Fly   178 VYVIGHSLGAHVAGYAGKNTDGQVHTII-----------GLDPALPLFSYNKPNKRL-----NSD 226
            .|:.|.|.|..:|...|::.  :.|.||           |.||.  ...::|..|.:     :.|
  Fly   170 GYMFGFSFGGQLASAVGRSL--RPHHIIESIDTCDMAGPGFDPI--AVDHSKAGKHVQCFHSSRD 230

  Fly   227 DAWYVESIQTN--GGTLGFLKPIGKGAFYPNGGKTQPGCPLDVTGACSHGRSTTYYAEAVSED-- 287
            ...:|.|...|  .|:.|..:|......:..                |||.....|.......  
  Fly   231 KGTFVYSCHRNIMLGSCGLKQPSVASQLHLG----------------SHGLCVDIYINTFDYPFY 279

  Fly   288 --NFGTMKCGDYEEAVAKECGSTYSSVRMGADTN-AYMVEGDFYVPVNSKAPFGM 339
              |:...:|..:::......|.|     :|.:.| ...|.|..:||.:...|:.:
  Fly   280 AVNYTPPECFTWQKTAKIPDGYT-----VGYEENFDSQVTGQIFVPTSLHYPYNL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 63/309 (20%)
Pancreat_lipase_like 68..333 CDD:238363 62/294 (21%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.