DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG6472

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:289 Identity:101/289 - (34%)
Similarity:164/289 - (56%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VNFYLFTPKNPSSSKHIYATTKS-ISKSNFNPAHPTRFVIHGWTQSYLNSMNS--DIRKAFLSKG 129
            :.|.|:|.:|.:|::.::.:..: :::||||..:|....:||:::|......|  :::.|||.:|
  Fly    44 IKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRG 108

  Fly   130 DYNVIVVDWARARSVD-YATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYA 193
            :||||::||:...:|. |:.:|..:..:|:.:|:.:.||.|. |.....:::||.||||.|||:|
  Fly   109 NYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK-GYPAKYIHLIGFSLGAEVAGFA 172

  Fly   194 GKNTDG---QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPN 255
            ||....   ::..|..||||||||..|..|:||:..||.:|:.|.|:||.||...|:|...||||
  Fly   173 GKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPN 237

  Fly   256 GGK-TQPGCP--------LDVTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEE-AVAKECGSTY 309
            ||: .||||.        |.:...|||.|:..|:.|::::. .|...:|...:. .:.:|.|...
  Fly   238 GGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGICREPGGGP 302

  Fly   310 SSVRMGADTNAYMVEGDFYVPVNSKAPFG 338
            :.:.||||..   :.|.||:..|...|||
  Fly   303 AFMGMGADPR---IRGKFYLDTNDAKPFG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 98/286 (34%)
Pancreat_lipase_like 68..333 CDD:238363 97/282 (34%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 97/282 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.