DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG17292

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:261 Identity:82/261 - (31%)
Similarity:124/261 - (47%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TRFVIHGWTQSYLNSMNSD----IRKAFLSKGDYNVIVVDWARARSVDYATSVMA-VAATGKKVA 161
            |...:||    ||...:.:    |.:|:|.:.|.|:||:||......:|...... :...|.::|
  Fly    61 TVLYLHG----YLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELA 121

  Fly   162 KMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAG----KNTDG--QVHTIIGLDPALPLFSYNKPN 220
            |::..:.| |||::...:::|||:|..:||..|    |.|.|  ::..|..||||.|||   .|.
  Fly   122 KVLLKMFD-HGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPG 182

  Fly   221 KRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGG-KTQPGCP------LDVTGACSHGRSTT 278
            ..|:::||.:|:.|.|:....|.....|...|:|||| ..|||||      |......||.||..
  Fly   183 THLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWW 247

  Fly   279 YYAEAVSE------DNFGTMKCGDYEE-AVAKECGSTYSSVRMGADTNAYMVEGDFYVPVNSKAP 336
            ::||:||:      |.....|..|::: .:.:.|    ..|.||..... .:.||||:..|...|
  Fly   248 FWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENC----PPVVMGHHCPT-TIHGDFYLQTNGHTP 307

  Fly   337 F 337
            |
  Fly   308 F 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 80/259 (31%)
Pancreat_lipase_like 68..333 CDD:238363 79/255 (31%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.