DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and pla1a

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:272 Identity:87/272 - (31%)
Similarity:125/272 - (45%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LEGRGLTTVPVNFYLFTPKNPS------------SSKHIYATTKSISKSNFNPAHPTRFVIHGW- 109
            ||.|..|.:.|.:.|.|.||.:            :.||         .:.||.:.||:.::||: 
Zfish    40 LEYRQATKLQVQYLLLTRKNANCASLFTQDCLNHTQKH---------TAYFNSSLPTKVIVHGYR 95

  Fly   110 TQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLN 174
            ......|..|.:.:|.|.:.|.||:||||....|..|...|........:::.:||.| ..:|..
Zfish    96 ALGSKPSWVSGLAQALLREEDVNVLVVDWVYGASFAYNLVVENYKEVAVQISVLINQL-TKYGST 159

  Fly   175 LNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGG 239
            |...:.||.||||||:|:.|....|::..|.|||||.|:|....|..||:|.||.:||:|.|:..
Zfish   160 LESFHFIGVSLGAHVSGFVGTLFHGKLGRITGLDPAGPMFKSADPFDRLDSSDALFVEAIHTDSD 224

  Fly   240 TLGFLKPIGKGAFYPNGGKTQPGCPLDVTGA------CSHGRSTTYYAEAVSEDNFGT-----MK 293
            ..|...|:|...|:.|||..|.||......:      |.|.|:...|..|::    |:     ..
Zfish   225 YFGISIPVGHVDFFLNGGMDQAGCARSRFASMYGYVICDHMRALHVYMSALN----GSCPLIGFP 285

  Fly   294 CGDYEEAVAKEC 305
            |..|||.:|.:|
Zfish   286 CSGYEEFLAGKC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 87/272 (32%)
Pancreat_lipase_like 68..333 CDD:238363 83/262 (32%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 87/272 (32%)
Pancreat_lipase_like 48..336 CDD:238363 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.