DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG18258

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:298 Identity:97/298 - (32%)
Similarity:136/298 - (45%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSK 128
            |::|:          :.::.::.||      .|....||...|.|||.|..||.:..:.||:|.:
  Fly   185 TSIPL----------TQAEQLWNTT------GFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCR 233

  Fly   129 GDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYV------IGHSLGA 187
            .|.||:::|.|......|..|.:.....|..:||.:        |.||..||      :||||||
  Fly   234 NDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKAL--------LRLNTSYVTKQFHLVGHSLGA 290

  Fly   188 HVAGYAGKN----TDGQV-HTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPI 247
            .:||.||:|    :.||: ..|.|||||.|.|......:.|.|.||.:|:.|.||.|..|..|..
  Fly   291 QIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRA 355

  Fly   248 GKGAFYPNGG-KTQPGC-PLDVTGACSHGRSTTYYAEAVSEDNFGTMKCGDYEEAVAKECGSTYS 310
            |...|:..|. ..:||| .||.. :|||.|:..|:.|.|...|      |:  :.:||.| ..||
  Fly   356 GDADFFVQGRIPFKPGCESLDPI-SCSHQRAVDYWTETVYPSN------GN--DFLAKRC-KRYS 410

  Fly   311 SVRMG---ADTNAYMVE-------GDFYVPVNSKAPFG 338
            .:.:|   .:||..|..       |.|||..|.:.|:|
  Fly   411 ELLLGNYCKNTNTVMGYAAKATDLGLFYVGANPEEPYG 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 95/295 (32%)
Pancreat_lipase_like 68..333 CDD:238363 92/287 (32%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 94/291 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.