DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and Yp3

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:271 Identity:78/271 - (28%)
Similarity:117/271 - (43%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RFVIHGWTQSY-LNSM--NSDIRKAFLSKGDYNVIVVD-----W--ARARSVDYATSVMAVAATG 157
            |.:|..:.|.| |..:  |:..::..|...||:....:     |  |:|.|.|.....:....|.
  Fly   142 RRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTN 206

  Fly   158 KKVAKMINFLK------------DNHGLNLNDVYVIGHSLGAHVAGYAGK----NTDGQVHTIIG 206
            .|...|::.|.            .|.|:....:::||..:.|||||.||.    .|..::..|.|
  Fly   207 FKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITG 271

  Fly   207 LDPALPLFSYNKPNKR------LNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQPGCPL 265
            ||||..|      :||      |:..||.:|::|.|:...:|.....|...|||||..|  |.|.
  Fly   272 LDPAKVL------SKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPST--GVPG 328

  Fly   266 DVTGACSHGRSTTYYAEAV---SEDNFGTMKCGDYEEAVAKECGSTYSSVRMGADTNAYMVEGDF 327
            ......:..|:|.|:||:|   ||.||..:.....::  .||.........||...: |.:.||:
  Fly   329 SENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQ--YKEQDGFGKRAYMGLQID-YDLRGDY 390

  Fly   328 YVPVNSKAPFG 338
            .:.||:|:|||
  Fly   391 ILEVNAKSPFG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 75/268 (28%)
Pancreat_lipase_like 68..333 CDD:238363 73/264 (28%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 75/268 (28%)
Abhydrolase <215..396 CDD:304388 56/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.