DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and CG5966

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:319 Identity:92/319 - (28%)
Similarity:145/319 - (45%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NFYLFTPKNPSSSKHI-YATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLS---KG 129
            :|.|.|.:.....|:: ....:|:.....||......::||:.:|.......|:.||.|:   :|
  Fly    79 HFTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEG 143

  Fly   130 DYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGL-NLNDVYVIGHSLGAHVAGYA 193
            ..:|:::||....|..|..:|..:...|...|.:::.|.:...| ||::|::||||||||::|||
  Fly   144 RASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYA 208

  Fly   194 GKNTDGQVH-------TIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNG-----GTLGFLKP 246
            |.:..   |       .|.|||||.|||:...|..||:..||.:|:.:.|:.     |.||....
  Fly   209 GYHLQ---HDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMR 270

  Fly   247 IGKGAFYPNGGKTQPGCP---LDVTG------------ACSHGRSTTYYAEAV-SEDNFGTMKCG 295
            :|...|:||||...|||.   .||..            .|:|.||..|:.|:: |:..|..:.|.
  Fly   271 LGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITCD 335

  Fly   296 DYEEAVAKECGST----YSSVRMGADTN---------AYMVEGD----FYVPVNSKAPF 337
            .:|.....:|.|.    ::.:|||..:.         ..:.:||    ||:......||
  Fly   336 SFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 90/317 (28%)
Pancreat_lipase_like 68..333 CDD:238363 90/313 (29%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 90/317 (28%)
Pancreat_lipase_like 76..390 CDD:238363 90/313 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.