DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and lpl

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:317 Identity:95/317 - (29%)
Similarity:135/317 - (42%) Gaps:55/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AEEWM----EAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHG 108
            |.|||    :.:.|...|.|.....:.....|..|          :||...|||....|..||||
Zfish    46 ATEWMMDFTDIESKFSFRTLEEPEDDLCYIVPGQP----------QSIKDCNFNTETKTFIVIHG 100

  Fly   109 WT-----QSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLK 168
            ||     :|::..:   :...:..:...|||||||.......|.||.......||.|||.:|:|:
Zfish   101 WTVTGMFESWVPKL---VTALYEREPSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQ 162

  Fly   169 DNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVES 233
            .........::::|:||||||||.||..|..:|:.|.|:|||.|.|.|......|:.|||.:|:.
Zfish   163 AEIDYPWEKLHLLGYSLGAHVAGIAGLLTKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDV 227

  Fly   234 IQTN-----GGTLGFLKPIGKGAFYPNGGKTQPGCPLD-------VTG--------ACSHGRSTT 278
            :.||     ..::|..:|:|....|||||..||||.|.       .||        .|||.||..
Zfish   228 LHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIH 292

  Fly   279 YYAEAV-------------SEDNFGTMKCGDYEEAVAKECGSTYSSVRMGADTNAYM 322
            .:.:::             |.|:|....|....:....:.|...:.:|....:..||
Zfish   293 LFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYM 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 91/304 (30%)
Pancreat_lipase_like 68..333 CDD:238363 88/293 (30%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 91/311 (29%)
Pancreat_lipase_like 56..353 CDD:238363 91/307 (30%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.