DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and Lipi

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:293 Identity:99/293 - (33%)
Similarity:153/293 - (52%) Gaps:33/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGW-----TQSY 113
            |...|:.....||.:|..:::..|...::.::.:..|:: :.|||:..|.::|||:     |..:
  Rat    45 AMNSLKDLFYPTVKINLLMYSRNNAKCAEPLFESNNSVN-ARFNPSKKTIWIIHGYRPLGSTPMW 108

  Fly   114 LNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVM---AVAATGKKVAKMINFLKDN---HG 172
            ::...    ||||.:.|.|:|||||.:.     ||:.:   ||..| :|||:::....:|   ||
  Rat   109 IHKFT----KAFLKQEDVNLIVVDWNQG-----ATTFIYGRAVKNT-RKVAEILREYIENLLIHG 163

  Fly   173 LNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTN 237
            .:|::.:.||.|||||:.|:.||...||:..|.|||||.|.||....|.||:..||.:|:.|.::
  Rat   164 ASLDNFHFIGMSLGAHICGFVGKLFQGQLGRITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSD 228

  Fly   238 GGTLGFLKPIGKGAFYPNGGKTQPGCPLDVTGA-----CSHGRSTTYYAEAVSED-NFGTMKC-- 294
            ....|.|:|.|...||||||:.|||||..:...     |.|.|:...:.||...: ||.:..|  
  Rat   229 SQGFGILEPSGHIDFYPNGGRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFETNCNFVSFPCRS 293

  Fly   295 -GDYEEAVAKECGSTY--SSVRMGADTNAYMVE 324
             .||:..:...||:.|  |..|:|...|.:..|
  Rat   294 YRDYKSGLCVGCGNLYKDSCPRLGIQANLWKEE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 98/290 (34%)
Pancreat_lipase_like 68..333 CDD:238363 95/279 (34%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 96/281 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.