DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:264 Identity:87/264 - (32%)
Similarity:127/264 - (48%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VPVNFYLFTPKNPSSSKHIYAT-TKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKG 129
            :...|.|:|.:||::.:.|.|| ..:|..|||.....|||::||:.....:....|:.|......
  Rat    65 IDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQVE 129

  Fly   130 DYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAG 194
            ..|.|.|||.|....:|..:.......|.::|.::..|....|.:..:|::|||||||||.|.||
  Rat   130 KVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAG 194

  Fly   195 KNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL------GFLKPIGKGAFY 253
            :..:|.|..|.|||||.|.|.......||:..||.:|:.|.|:...:      |..:.:|...|:
  Rat   195 RRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFF 259

  Fly   254 PNGGKTQPGCP-------LDVTG---------ACSHGRSTTYYAEAV-SEDNFGTMKCGDYEEAV 301
            |||||..|||.       :|:.|         ||:|.||..|||.:: :.|.|....|..||:..
  Rat   260 PNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQ 324

  Fly   302 AKEC 305
            ..:|
  Rat   325 QNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 87/264 (33%)
Pancreat_lipase_like 68..333 CDD:238363 87/262 (33%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 87/264 (33%)
Pancreat_lipase_like 65..363 CDD:238363 87/264 (33%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.