DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:355 Identity:98/355 - (27%)
Similarity:159/355 - (44%) Gaps:72/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEEWMEAQEKLEGRGLTTVPV 68
            ||.|.:........||||...:||                   |.:.::|     :.|.|:.|..
Zfish    10 FLWLVLNITGPFIAALEEGNVLNG-------------------VFDHFLE-----DLRDLSDVKK 50

  Fly    69 NFYLFTPKNPSSSKH-----IYATTKSISKSNFNPAHPTRFVIHGWT-----QSYLNSMNSDIRK 123
            ....|:.:|||....     :....:::|..|||....|..||||||     :|::..:   :..
Zfish    51 LNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKL---VAA 112

  Fly   124 AFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAH 188
            .:..:.|.|||||||.......|..:.......|:::...|:::::...:.|.::::||:|||||
Zfish   113 LYNREKDANVIVVDWLDTAQDHYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAH 177

  Fly   189 VAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQT-----NGGTLGFLKPIG 248
            |||:||.:|..::..|.|||||.|.|.....:.||:.|||.:|:.:.|     .|.::|..:|:|
Zfish   178 VAGFAGSHTTNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVG 242

  Fly   249 KGAFYPNGGKTQPGCPLDVTGA-----------------CSHGRSTTYYAEA-VSEDNFG-TMKC 294
            ....|||||..||||  ::.||                 |.|.||...:.:: ::|:..| ...|
Zfish   243 HVDIYPNGGSFQPGC--NLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSC 305

  Fly   295 GD---YEEAVAKECGSTYSSVRMGADTNAY 321
            |.   ::..|..:|.      :.|.:|..|
Zfish   306 GSNDMFDRGVCLQCR------KNGCNTVGY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 87/302 (29%)
Pancreat_lipase_like 68..333 CDD:238363 84/291 (29%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 85/294 (29%)
Pancreat_lipase_like 51..347 CDD:238363 84/290 (29%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.