DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6271 and lipib

DIOPT Version :9

Sequence 1:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:316 Identity:90/316 - (28%)
Similarity:146/316 - (46%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEEWMEAQEKLEGRGLTTVPVN 69
            ::|:||.|...    |:::..|               :.|:|..|.::.          |.:.|.
Zfish     8 ILLSIFLLCKG----EDNDCDN---------------FTDLDFHESFIG----------TNLYVR 43

  Fly    70 FYLFTPKNPSSSK---HIYATTKSISKSNFNPAHPTRFVIHGWTQS-----YLNSMNSDIRKAFL 126
            ..|:|..|....:   |...|.:.:    ||...||.|||||:..:     ::|    .|.....
Zfish    44 LLLYTRANLECGQELPHHNFTQQPL----FNVTRPTTFVIHGYRPTGAPPIWIN----HIVHLLA 100

  Fly   127 SKGDYNVIVVDWAR-ARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVA 190
            ::.|.|::||||.| |.:::|.|:|.....|...:.:.|..: :..|.:|:.:::||.|||||||
Zfish   101 AQKDMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESM-EKEGASLDSIHLIGVSLGAHVA 164

  Fly   191 GYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPN 255
            |:.|....|:|..|.|||||.|:|:...|.:||:..||.:|:.:.|:..:.|.....|...||.|
Zfish   165 GFIGAMLGGRVGRITGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYAN 229

  Fly   256 GGKTQPGCPLDVTG-----ACSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVAKEC 305
            ||..|||||..:..     .|.|.||...|..:::.. :.....|..|.:.::.:|
Zfish   230 GGLDQPGCPKTIFSGKSYFVCDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6271NP_651526.1 Lipase 57..337 CDD:278576 81/264 (31%)
Pancreat_lipase_like 68..333 CDD:238363 80/253 (32%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 81/268 (30%)
Pancreat_lipase_like 40..324 CDD:238363 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.