DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Pla1a

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:298 Identity:94/298 - (31%)
Similarity:154/298 - (51%) Gaps:27/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYT--ASMNKDIRS 123
            || |.:.|:|.|:|.|:|:.|:.:...: .|.:|.||::..|:.:|||:....|  :.::|.| |
Mouse    45 RG-TNLKVQFLLFTPSDPSCGQLVEEGS-DIRSSEFNASLGTKVIIHGFRALGTKPSWIDKFI-S 106

  Fly   124 AWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAH 188
            |.|...|.|||.|||....:..|.::|..|.....::::.::.|.: .|::.:.:::||.|||||
Mouse   107 AVLRAADANVIAVDWVYGSTGVYYSAVENVVKLSLEISRFLSKLLE-LGVSESSIHIIGVSLGAH 170

  Fly   189 VAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFY 253
            |.|..|....||:..|.|||||.|.::.....:||::.||.:||:|.|:...||...|:|...::
Mouse   171 VGGMVGHFYKGQLGQITGLDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYF 235

  Fly   254 PNGGKTQPGC------GLDLTGACSHGRSTTYYAEAVSEDNFGTM--KCGDYEEAVSKECGSTY- 309
            .|||:.||||      |.:.. .|.|.|:...|..|: |:....|  .|..|:..::.:|...: 
Mouse   236 VNGGQDQPGCPAFFHAGYNYL-ICDHMRAVHLYISAL-ENTCPLMAFPCASYKAFLAGDCLDCFN 298

  Fly   310 ----SSVRMG-ADTNAYMVEG-----DYYVPVNSKAPF 337
                |..|:| .:....|:|.     ..|:...|.||:
Mouse   299 PFLLSCPRIGLVERGGVMIEPLPKEVKVYLLTTSSAPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 88/285 (31%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 93/296 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835277
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.