DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and Pnlip

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:320 Identity:96/320 - (30%)
Similarity:145/320 - (45%) Gaps:46/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WMEAQELLESRGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTA 115
            |..||          :..:|.|||:.||...:.||:...:|..|:|.:...||.:|||:......
Mouse    46 WSPAQ----------INTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEE 100

  Fly   116 SMNKDIRSAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYV 180
            :...|:..........|.|.|||.......|..:...|...|.:||.::|.|:.:.|.:||::::
Mouse   101 NWLSDMCKNMFRVESVNCICVDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHL 165

  Fly   181 IGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL---- 241
            ||||||:|:||.|||.|.|.:..|.|||||.|.|.......||:..||.:|::|.|:.|.:    
Mouse   166 IGHSLGSHIAGEAGKRTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNL 230

  Fly   242 --GFLKPIGKGAFYPNGGKTQPGCG-------LDLTG---------ACSHGRSTTYYAEA-VSED 287
              |..:.:|...|:||||...|||.       :|:.|         ||:|.||..:|.:: |:..
Mouse   231 GFGMSQTVGHLDFFPNGGIEMPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPT 295

  Fly   288 NFGTMKCGDYEEAVSKE---CGS-------TYSSVRMGADTNAYMVEGDYYVPVNSKAPF 337
            .|....|..|....:.:   |||       .|:....|..:..|..   :|:....|:.|
Mouse   296 GFAGFSCSSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQT---FYLNTGDKSNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 91/297 (31%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 95/318 (30%)
Pancreat_lipase_like 51..348 CDD:238363 91/299 (30%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.