DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG34447

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:135/277 - (48%) Gaps:8/277 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDYN 132
            :.|:||  ||.|:...|......::..:|....|.:.:|||:|.....:.|..||...|...|..
  Fly    42 ISFWLY--SNSTRENPILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHEDVY 104

  Fly   133 VIVVDWA-RARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKN 196
            ||.:|:. ..|...|..:|..:....:.:|::||.|.|...:..:.:::||.|||..|||.....
  Fly   105 VISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANY 169

  Fly   197 TDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQP 261
            ...::..|.|||||.|||.....::||:..||.:|:.|.|:....|:|:..|...||||.|..||
  Fly   170 VKRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQP 234

  Fly   262 GC---GLDLTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVSKECGSTYSSVRMGADTNAYM 322
            ||   .:....:|:|.|:..:|||:::.. .|...:|..:...:...|.:|.:...:|...:..:
  Fly   235 GCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQALLGYHVSDEL 299

  Fly   323 VEGDYYVPVNSKAPFGM 339
             .|.|::...||:|:.:
  Fly   300 -RGSYFLQTASKSPYAL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 78/269 (29%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.