DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and PNLIP

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:267 Identity:88/267 - (32%)
Similarity:134/267 - (50%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGW----TQSYTASMNKDIRSAWL 126
            |..:|.|||:.||...:::.|.:.||..|:|.:...|||:|||:    .:::.|::.|::    .
Human    51 VNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNL----F 111

  Fly   127 SRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAG 191
            .....|.|.|||.......|..:...:...|.:||..:.||:...|.:.::::|||||||||.||
Human   112 KVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAG 176

  Fly   192 YAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL------GFLKPIGKG 250
            .||:.|:|.:..|.|||||.|.|.......||:..||.:|:.|.|:|..:      |..:.:|..
Human   177 EAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHL 241

  Fly   251 AFYPNGGKTQPGCG-------LDLTG---------ACSHGRSTTYYAEA-VSEDNFGTMKCGDYE 298
            .|:||||...|||.       :|:.|         ||:|.||..||.:: |:.|.|....|..|.
Human   242 DFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYN 306

  Fly   299 EAVSKEC 305
            ...:.:|
Human   307 VFTANKC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 87/265 (33%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 88/267 (33%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.