DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lipia

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:322 Identity:106/322 - (32%)
Similarity:156/322 - (48%) Gaps:51/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AQELLESRGL--------TTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHG-- 108
            |||..|...|        |::.|:..|||.::|:.| ::.:..:....|.||.:..|.|:|||  
Zfish    23 AQECEEMTDLNFKDSLAGTSLKVRLLLYTRADPSCG-QLLSHQEPFSNSQFNVSSVTTFLIHGYR 86

  Fly   109 -------WTQSYTASMNKDIRSAWLSRGDYNVIVVDWAR-ARSVDYATSVLAVAATGKKVAKMIN 165
                   |.:.:...:        |:|.|.|||||||.| |.:::|...|.........:..:|.
Zfish    87 PTGSPPVWMKQFVEFL--------LNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQ 143

  Fly   166 FLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWY 230
            .:||| |.||:.:::||.|||||::|:.|.|.:|::..|..||||.|.|:...|..||:..||.:
Zfish   144 KMKDN-GANLSSIHMIGVSLGAHISGFTGANFNGEIGRITALDPAGPEFNGRPPEDRLDPSDALF 207

  Fly   231 VESIQTNGGTLGFLKPIGKGAFYPNGGKTQPGCGLD-LTGA----CSHGRSTTYYAEAV------ 284
            ||::.|:...||:...:|...:|.|||..||||... |:|:    |.|.||...|..:|      
Zfish   208 VEALHTDMDALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPI 272

  Fly   285 ------SEDNF--GT-MKCGDYEEAVSKECGSTYSSVRMGADTNAYMVEGDYYVPVNSKAPF 337
                  |..:|  || |.||.::.|.....|  |.|||. .||...:.:...|...|..:||
Zfish   273 IAYPCESYTDFQDGTCMDCGKFKSAGCPIFG--YDSVRW-RDTLVQLEQTRTYFQTNKASPF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 97/294 (33%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 97/296 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9151
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.