DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG4582

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:298 Identity:101/298 - (33%)
Similarity:150/298 - (50%) Gaps:40/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESRGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRS 123
            :::..|:.||..|               ...|:..|.|:..:|||.:||||..:..|:|..::..
  Fly   137 QNQQFTSEPVNLY---------------DAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLP 186

  Fly   124 AW--LSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLG 186
            |:  |..|:||:..|||.|....||.|:...|...|:.:||.::||....|:...||.::|.|:|
  Fly   187 AYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMG 251

  Fly   187 AHVAGYAGKNTD-GQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKG 250
            |||||.|||:.. |::..|..||||||.|.|.||.:||.::||.|||.:.|:.|:.||.:|:|..
  Fly   252 AHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHV 316

  Fly   251 AFYPNGGKTQPGCGLDLTGACSHGRSTTYYAEAVSED---NFGTMKC--GDYEEAV-----SKEC 305
            .||.|.|..||||   ....|||.|:...:||:::.|   .|.:..|  .::::..     .|:.
  Fly   317 DFYANWGSQQPGC---FWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDT 378

  Fly   306 GSTYSSVRMGADTNAYMVE------GDYYVPVNSKAPF 337
            |...:   ||.|......|      |.||...|.:.|:
  Fly   379 GVMQT---MGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 97/283 (34%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 99/291 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438401
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.