DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lipca

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:305 Identity:85/305 - (27%)
Similarity:136/305 - (44%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FYLYTSSNPTKGKKITASTK-----SIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSR- 128
            |.:||....|:.   |.:.:     ::||..|||:.|...:||||  |....|.|     |:|| 
Zfish    46 FRVYTDGEYTED---TCALELFQPHTLDACGFNSSLPLAIIIHGW--SVDGMMEK-----WISRL 100

  Fly   129 --------GDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSL 185
                    |:.||::.||.......|..:.......|:.:|.::::|:|.....|..:::||:||
Zfish   101 ASALKSSEGNINVLIADWLTLAHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYSL 165

  Fly   186 GAHVAGYAGKNTDGQVHT---IIGLDPALPLFSYNKPNKRLNSDDAWYVESIQT-----NGGTLG 242
            |||::|:||.|......|   |.|||||.|:|.......||:.:||.:|::|.|     .|.::|
Zfish   166 GAHISGFAGSNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVG 230

  Fly   243 FLKPIGKGAFYPNGGKTQPGC-----------------GLDLTGACSHGRSTTYYAEAV--SEDN 288
            ..:|:....||||||..||||                 |.:.|..|:|.|:...:.:::  .:..
Zfish   231 IKQPVAHFDFYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQ 295

  Fly   289 FGTMKCGD---YEEAVSKEC--------GSTYSSVRMGADTNAYM 322
            ....||.|   :::....:|        |.....||.|.....::
Zfish   296 IMAYKCSDNTAFDKGNCLDCRKNRCNTLGYDIKKVRTGKSKRLFL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 85/305 (28%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 85/305 (28%)
Pancreat_lipase_like 54..344 CDD:238363 82/297 (28%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.