DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and lipg

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:294 Identity:97/294 - (32%)
Similarity:142/294 - (48%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GKKITASTKSIDASSFNSAHPTRFVIHGWTQS--YTASMNKDIRSAWLSRGDYNVIVVDWARARS 143
            |||     :||.|..||:...|..:|||||.|  :.:.|:|.:.:......:.||:||||....:
Zfish    73 GKK-----ESIVACGFNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLAN 132

  Fly   144 VDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTIIGLD 208
            ..|..:|......|:.:|.::::|::...|.|.::::||:|||||||||||...:|.:..|.|||
Zfish   133 QLYPDAVNHTRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGIIGRITGLD 197

  Fly   209 PALPLF----SYNKPNKRLNSDDAWYVESIQTN-----GGTLGFLKPIGKGAFYPNGGKTQPGC- 263
            ||.|:|    ||||    |:.|||.:|:.:.|.     |.::|..:|||....|||||..|||| 
Zfish   198 PAGPMFEGADSYNK----LSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCT 258

  Fly   264 -GLDLTGA---------CSHGRS-------------TTYYAEAVSEDNFGTMKCGDYEEAVSKEC 305
             |..|:.|         |.|.|:             .:|..:....|.|   |.|.........|
Zfish   259 FGEFLSAASGNFMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRF---KKGICLSCRKNRC 320

  Fly   306 GST-YSSVRMGADTNAYMVEGDYYVPVNSKAPFG 338
            .|. |::.:|....|:.|     |:...:..|||
Zfish   321 NSIGYNAKKMRKRRNSKM-----YLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 94/287 (33%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 97/294 (33%)
Pancreat_lipase_like 65..344 CDD:238363 94/287 (33%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.