DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG13562

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:352 Identity:73/352 - (20%)
Similarity:119/352 - (33%) Gaps:91/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DGTSEWVDMDVA----EQWMEA--------QELLESRGLTTVPVKFYLYTSSNPTKGKKITASTK 89
            |||...:::..|    :|..:|        |:.::.....|:.|.||    .|.||..:.:|...
  Fly    20 DGTHSKLNLKYAILRQKQAAKATQNDTLAHQQRIKYDAQKTMKVMFY----KNNTKTMETSAYDD 80

  Fly    90 SIDASSFNSAHPTRF--VIHGWTQSYTASMNKDIRSAW----LSRGDYN----VIVVDWARARSV 144
            :.|.|....:...:|  |:|||.||.:        ..|    :.|..|.    ||.:|::...|.
  Fly    81 AYDLSGSGCSPTDKFAIVLHGWIQSCS--------DEWALSLIERLSYYRGGCVICIDYSVVASS 137

  Fly   145 DYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDGQVHTII---- 205
            .|.............::.:|..| ...|.:....|:.|.|.|..:|...|::.  :.|.||    
  Fly   138 SYMRLYTNFDTLTGAISSIILTL-FRQGFDPKRGYMFGFSFGGQLASAVGRSL--RPHHIIESID 199

  Fly   206 -------GLDPALPLFSYNKPNKRL-----NSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGK 258
                   |.||.  ...::|..|.:     :.|...:|.|...|         |..|:       
  Fly   200 TCDMAGPGFDPI--AVDHSKAGKHVQCFHSSRDKGTFVYSCHRN---------IMLGS------- 246

  Fly   259 TQPGCGLDLTGAC------SHGRSTTYYAEAVSED----NFGTMKCGDYEEAVSKECGSTYSSVR 313
                |||......      |||.....|.......    |:...:|..:::......|.|     
  Fly   247 ----CGLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYT----- 302

  Fly   314 MGADTN-AYMVEGDYYVPVNSKAPFGM 339
            :|.:.| ...|.|..:||.:...|:.:
  Fly   303 VGYEENFDSQVTGQIFVPTSLHYPYNL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 64/301 (21%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.