DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG13282

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:355 Identity:102/355 - (28%)
Similarity:157/355 - (44%) Gaps:31/355 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILAFF--------ALAASAIPIKESERVHGENGWYVPQEDGTSEWVDMDVAE---QWMEAQELL 58
            |:||.|        .|....|||:..:....| |...|....|:...:.|:..   :|      .
  Fly    10 LLLASFNRETIGKRFLNLKPIPIQHEDESSTE-GSTNPTPTSTTTPSNRDITIGPCKW------A 67

  Fly    59 ESRGLTTVPVKFYLYTSSNPTKGKKI----TASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNK 119
            ..|......||:|:||..||...:.:    :....::..|.||..:||:.:|||:.........:
  Fly    68 IGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQ 132

  Fly   120 DIRSAWLSRGDYNVIVVDWA-RARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGH 183
            .:|..:|::.|||:|.|||: .:....|.::|......|...|:::..|.:...   .|::|||.
  Fly   133 QMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGN---TDIHVIGF 194

  Fly   184 SLGAHVAGYAGKNTDG-QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPI 247
            ||||.|..|..:|... .:..|.|||||:|||..:....:|:..||.||:.|.||....|.::..
  Fly   195 SLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERC 259

  Fly   248 GKGAFYPNGGKTQPGC-GLDLTG-ACSHGRSTTYYAEAV-SEDNFGTMKCGDYEEAVSKECGSTY 309
            |...||.|||..|||| |..:.. ||||.|:..|:.|:: |...|....|..|...:...|..|.
  Fly   260 GHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTN 324

  Fly   310 SSVRMGADTNAYMVEGDYYVPVNSKAPFGM 339
            ..:..|.:... ...|.:.:..|..:||.:
  Fly   325 FLLEAGENIRP-TTRGMFMIDTNDSSPFAL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 84/273 (31%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 86/287 (30%)
Pancreat_lipase_like 75..347 CDD:238363 84/275 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.