DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6277 and CG18641

DIOPT Version :9

Sequence 1:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:146/286 - (51%) Gaps:21/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VKFYLYTSSNPTKGKKI-TASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDY 131
            ::|||||.....:.:.| .....::..:.||..|||:.:|||:....|.|.:.|:|.|:.|.|:|
  Fly    70 IQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGEY 134

  Fly   132 NVIVVDWARA------RSVDYATSVLAVAATGKKVAKMINFL-KDNHGLNLNDLYVIGHSLGAHV 189
            |:|:||:|.|      ..:|:|....::.     :::::.:| :...|:..:||:.||:|:|||:
  Fly   135 NIIIVDYADAVKEPCLSQMDWAPRFGSLC-----ISQLVKYLARHPRGVQPDDLHFIGYSVGAHI 194

  Fly   190 AGYAG---KNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGA 251
            ||...   |..:|::..|..|||.:..::....::.|:|.||.:|:.:.|..|.||.....|...
  Fly   195 AGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHAD 259

  Fly   252 FYPNGGKTQPGC----GLDLTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVSKECGSTYSS 311
            ||.|||..||.|    .|..|.||.|.:.|.|:.|:::.. .|....|.:....:...|....|.
  Fly   260 FYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSE 324

  Fly   312 VRMGADTNAYMVEGDYYVPVNSKAPF 337
            ..:..:..::...|:|||..|:||||
  Fly   325 YVLMGEHCSHKARGNYYVTTNAKAPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 82/280 (29%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 82/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.